SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000754 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000754
Domain Number 1 Region: 25-164
Classification Level Classification E-value
Superfamily PX domain 0.00000000000818
Family PX domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000754
Domain Number - Region: 291-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.015
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000754   Gene: ENSPANG00000025890   Transcript: ENSPANT00000014896
Sequence length 403
Comment pep:known_by_projection chromosome:PapAnu2.0:14:8256180:8260319:-1 gene:ENSPANG00000025890 transcript:ENSPANT00000014896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KETSLDQLQMGRPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSV
VRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMK
QELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGG
FLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELM
DFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
Download sequence
Identical sequences ENSPANP00000000754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]