SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000759 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000759
Domain Number 1 Region: 77-148
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.89e-20
Family Skp1 dimerisation domain-like 0.000045
Further Details:      
 
Domain Number 2 Region: 3-66
Classification Level Classification E-value
Superfamily POZ domain 0.000000000133
Family BTB/POZ domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000759   Gene: ENSPANG00000003999   Transcript: ENSPANT00000012188
Sequence length 152
Comment pep:novel chromosome:PapAnu2.0:6:74762571:74763047:-1 gene:ENSPANG00000003999 transcript:ENSPANT00000012188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKVLSSDGEIFDVKIAKQSMTIKTMSEDLRMDDADNDAAPLPNVNVAIFKVIWWYTH
HKNGPPPPKDDANKENEQDQEFLKVDQGILSVLLPANYLDIKGLLDVTCETVANMIKEKS
PEKICKTSNIKNDFTEEEETHVHQENQWYEQK
Download sequence
Identical sequences ENSPANP00000000759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]