SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000764 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000764
Domain Number 1 Region: 58-114
Classification Level Classification E-value
Superfamily Kringle-like 2.17e-17
Family Fibronectin type II module 0.0046
Further Details:      
 
Domain Number 2 Region: 27-70
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000914
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000764   Gene: ENSPANG00000012802   Transcript: ENSPANT00000022226
Sequence length 115
Comment pep:known_by_projection chromosome:PapAnu2.0:19:41239602:41241186:-1 gene:ENSPANG00000012802 transcript:ENSPANT00000022226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRQWLDNLSLNTPGNRGRILFSLDGECVFPFHYKNGTYYDCIRSKSRHKWCSLNETYEG
YWKYCSAEDFASCVFPFWYRRLIYWDCTDHGEAFGKKWCSLTKNFNKDRIWKYCE
Download sequence
Identical sequences ENSPANP00000000764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]