SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000819 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000819
Domain Number 1 Region: 55-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.14e-44
Family Regulator of G-protein signaling, RGS 0.000000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000819   Gene: ENSPANG00000004518   Transcript: ENSPANT00000001768
Sequence length 202
Comment pep:known_by_projection chromosome:PapAnu2.0:1:181678386:181685726:1 gene:ENSPANG00000004518 transcript:ENSPANT00000001768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSSGKFEWGSKHGKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIQSATKRASRAHRIFEE
FICSEAPKEVNIDHETRELTRMNLQTVTATCFDTAQGKTRTLMEKDSYPRFLKSPTYRDL
AAQASAASATPSSCSLAEPSHT
Download sequence
Identical sequences A0A096MMI6
ENSPANP00000000819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]