SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000840 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000840
Domain Number 1 Region: 549-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-82
Family Protein kinases, catalytic subunit 0.000000399
Further Details:      
 
Domain Number 2 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-59
Family FCH domain 0.00083
Further Details:      
 
Domain Number 3 Region: 451-581
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-31
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000840   Gene: ENSPANG00000006161   Transcript: ENSPANT00000007404
Sequence length 822
Comment pep:known_by_projection chromosome:PapAnu2.0:6:102498791:102875635:1 gene:ENSPANG00000006161 transcript:ENSPANT00000007404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYLGVHQQ
IEAEMIKVTKTELEKLKSSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTADKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
EELKQSVQQLRCTEAKFSVQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALSSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWILSHEDVTLGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQNCPEDIFKIMMKCWDYKPENRPKFSELQKELTIIKKKLT
Download sequence
Identical sequences ENSPANP00000000840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]