SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000851 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000851
Domain Number 1 Region: 1647-1700,1943-2140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-51
Family Tandem AAA-ATPase domain 0.0000724
Further Details:      
 
Domain Number 2 Region: 1446-1751
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-49
Family Tandem AAA-ATPase domain 0.0000406
Further Details:      
 
Domain Number 3 Region: 208-271
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000179
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000851   Gene: ENSPANG00000024984   Transcript: ENSPANT00000007594
Sequence length 2414
Comment pep:known_by_projection chromosome:PapAnu2.0:X:68030668:68311784:-1 gene:ENSPANG00000024984 transcript:ENSPANT00000007594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGT
SSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDDETVNEDASNENSENDITMQSLPKGT
VIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGEDGLHGIVSCTACGQQVNHFQKDS
IYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCIL
RNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKKKIKVDSEKS
NKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSVTYSYSALIVPKEMIKKAKKLIETTAN
MNSSYVKFLKQATDNSEISSATKLRQLKAFKSVLADIKKAHLALEEDLNSEFRALDAVNK
EKNTKEHKVIDAKFETKARKGEKPCALERKDISKSEAKLSRKQVDSEHMDQNVPTEEQRA
NKSTGGEHKKSDRKEEPQYEPANTSEDLDMDIVSVPSSVPEDIFENLETAMEVQSSADHQ
GDGSSGTEQELESASVKLNISSKDNRGGIKSKTTAKVTKELYVKLTPVSLSNSPIKGADC
QEVPQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVKTTPLR
RQTETNPVTSNSDEECNETVKEKQKLPIPVRKKDKRNSSDSAIDNPKPNKLPKSKQSETV
DQNSDSDEMLAILKEVSRMSHSSSSDTDVNEIHTNHKTLYDLKTQAGKDDKGKRKRKSST
SGSDFDTKKGKSAKSAIISKKKRQTARTTKKRIPNTKDFDSSEDEKHSKKGMDNQGHKGL
KTSQEGSSDDAERKQDRENFSSAEGTVDKDTTIMELRDRLPKKQQASASSDVVSKLSGKE
ESFTSLDVRKVAETKEKSKHLKTKTCKKVQDGLSDIAEKFLKKDQSDETSEDVSDFKKKV
IKMEQQYESSSDGTEKLPEREEICHFPKGNELSDYAEKSTGKGDSCDSSEDKKSKNGAYG
REKKRCKLLGKSSRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNLSSKRNTKE
IQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADITSSSSDIE
DDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDDDDDDNDPEN
RIAKKMLLEEIKANLSSDEDGSSDDEPEEGDEVTANKQTEEGFIDLEAKNQINSESDSDS
EESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVQVSSEDSEDSDFQE
SGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKGNKSCSE
ISQFEFFCIYAGLHKEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKR
IAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVD
GVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVC
PLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMY
RNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIIL
TGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHI
LYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTPIQCKLYQYYLDHLTGVGNNSEGGRG
KAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSMSLSSDD
YTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEES
KATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLIS
LDLIEDFLELASREKTEDKDKPLIYKGEGKWLRNIDYYRLDGSTTAQSRKKWAEEFNDET
NVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFL
AQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKR
DTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHAAWAEYEAEKKGLTMRFNIPTGTNLP
PVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVW
KENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQY
NQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMYQPVAGGMQPPPLQRAPPP
MRSKNPGPSQGKSM
Download sequence
Identical sequences ENSPANP00000000851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]