SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000858 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000858
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000184
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000982
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 76-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000858   Gene: ENSPANG00000002875   Transcript: ENSPANT00000011805
Sequence length 480
Comment pep:known_by_projection chromosome:PapAnu2.0:6:77971114:78415215:-1 gene:ENSPANG00000002875 transcript:ENSPANT00000011805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVAVWLLVGVSLCVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPQGFNGIHCQHNI
NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences A0A096MMM3 A0A0D9RQQ2 A0A1D5RFH0 A0A2K5IHZ7 A0A2K5WYU7 A0A2K5YLW5 A0A2K6DVL4
ENSMMUP00000010071 ENSMMUP00000010068 9544.ENSMMUP00000010071 ENSPANP00000000858 XP_001082527.1.72884 XP_005557384.1.63531 XP_007975667.1.81039 XP_011728273.1.29376 XP_011799618.1.43180 XP_011851845.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]