SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000870 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000870
Domain Number 1 Region: 8-263
Classification Level Classification E-value
Superfamily SET domain 1.62e-42
Family Viral histone H3 Lysine 27 Methyltransferase 0.084
Further Details:      
 
Domain Number 2 Region: 345-417
Classification Level Classification E-value
Superfamily TPR-like 0.000027
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000870   Gene: ENSPANG00000013753   Transcript: ENSPANT00000024877
Sequence length 434
Comment pep:known_by_projection chromosome:PapAnu2.0:1:150791564:150847208:-1 gene:ENSPANG00000013753 transcript:ENSPANT00000024877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFARKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSRHLEFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGA
LQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKD
HPYISEIKQEIESH
Download sequence
Identical sequences ENSPANP00000000870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]