SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000994 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000994
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000159
Family Single strand DNA-binding domain, SSB 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000994   Gene: ENSPANG00000000427   Transcript: ENSPANT00000025738
Sequence length 1000
Comment pep:known_by_projection chromosome:PapAnu2.0:14:72894779:72928004:1 gene:ENSPANG00000000427 transcript:ENSPANT00000025738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRRRKFLLASVLALQNSSFIYPSCQKCFSRIILVSKRSKCPKCGCTGESGNANYRYKLS
LKVAESNKLSVITVFGSCLDTFFGLTASGLYRSRYIQDPNKIPETLDNDTTQNLLTKAVE
TCFVGQSFIFGVTNFESHPGQGADASNFLQQCSDHKRKARSLVACQIVLPDPGVAGFTVI
DYFCQLLQTFNFRKLQCDSHAPNNHLLSLDHSNSDLSSIYTSDSTSYFFKSCSKDTFSKF
WQPSLEFTSIVSKLTDNDDFSASEQSKAFGTLQQNRNSISIAEATGSSSCHDPIQHSWSL
VSYMDKKSTAEKLGKELGLQAKELSAVHSSHHEIGVNDSNLFSLEMREPLESSNTKSFHS
AVEIKNRSQHEPPCFQHHGIDTPTSLQKRSTCCPPSLVRLEVTASNSQDGDPQIWDDLPF
SESLNKFLAVLESEIAITQADVSSRKHHVDNDIDTFHADHSRLSVTPQRTTGALHTPPIA
LRSSQAIVKANCSKDDFLFNCKVNLSPSVEKESQPDNKVEAVSVNHSGRGMSEYFLPNPC
LSALFSSSKDSETIVTLKKTIRISPPRPSTSESDHFSLNNKYLNGCGEKSLSVMNEKLTT
LCSRKYNDVSDLCKLENKQYYRWSKNQDDSFTICRKLTYPLETLCNSPNRSTNTLKEMPW
GHINNNLTQSYSIGYEGSYDASADLFDDIAKEMDIATEITKKSQEILLQQGTSLAESHPS
ESDFSLRSLSEDFIQPSQKLSLQSISGSRRSRTCSPTPQFQSDSEYNVENSQDFVPCSQS
TPISGFHQTRIHGINRAFKKPVFYSDLDANYEKIRIFPENDKQQASPSCPKNIKTPSQKI
RSPIVSGISQPEVFNPSPFAECHETDSDEWVPPTTQKIFPSDMLGFQVIGLGKCLAAHHF
PDQELPRKKLKHIRQGTNKGLIKKKLKNMLTAVVMKEKTPKYNCKSSGWISKCPDIQVLA
APQLHPILGPDSCLECCLPFSEKGPPSVCDTQSAWSPELF
Download sequence
Identical sequences ENSPANP00000000994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]