SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000999 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000999
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Globin-like 2.17e-49
Family Globins 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000999   Gene: ENSPANG00000008373   Transcript: ENSPANT00000011351
Sequence length 146
Comment pep:known chromosome:PapAnu2.0:14:60039115:60042001:1 gene:ENSPANG00000008373 transcript:ENSPANT00000011351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKTVVSALWGKVNVDAVGGEALGRLLVVHPWTQRFFESFGDLSSPAAMGNPKV
KAHGKKVLGAFSDVLAHLDNIKGTFSQLSELHCDKLHVDPGNFRLLGNVLVCVLAHNFDK
EFTLQVQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences ENSPANP00000000999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]