SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001022 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001022
Domain Number 1 Region: 245-333
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000136
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1126-1247
Classification Level Classification E-value
Superfamily TPR-like 0.00000000123
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 3 Region: 739-946
Classification Level Classification E-value
Superfamily TPR-like 0.00000000285
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number 4 Region: 976-1112
Classification Level Classification E-value
Superfamily TPR-like 0.0000000341
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Domain Number 5 Region: 527-659
Classification Level Classification E-value
Superfamily TPR-like 0.0000705
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001022
Domain Number - Region: 178-251
Classification Level Classification E-value
Superfamily SH3-domain 0.00445
Family SH3-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001022   Gene: ENSPANG00000012855   Transcript: ENSPANT00000024808
Sequence length 1288
Comment pep:known_by_projection chromosome:PapAnu2.0:6:142566826:142625117:-1 gene:ENSPANG00000012855 transcript:ENSPANT00000024808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFCIPRERSLTRGPGKETPSKDPTISSECIASSEYKEKCFLPQNMNPDLTLSFCVKS
RSRRCVNGPLQEAARKRLWALENEDQEVRMLFKDLSARLVSIQSQRSQFLITFKTMEEIW
KFSTYLNLGYVSVCLEHLLFDHKYWLNCILVEDTEIQVSVDDKHLETIYLGLLIQEGHFF
CRALCSVTPPAEKEGECLTLCKNELISVKMAEAGSELEGVSLVTGQRGLVLVSALEPLPL
PFHQWFLKNYPGSCGLSRKRDWTGSYQIGRGRCKAMKSYEPEEKDELSFYQGESIEIIGF
VIPGLQWFIGKSMSSGQVGFVPTRNIDPDSYSPMSRNFAFFSDEERCSLLALGSDKQTEC
CSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQPEGFKEVRPGRAWEEHQAVGSRQSS
SSEDSSLEEELLSATSDSYHLPEPDDLDDPELLMDLSTDQEEEAENFTPILAFLDHEGYA
DHFKSLYDFSFSFLTSSFYSFSEEDEFVAYLEASRKWAKKSHMTWAHARLCFLLGRLSVR
KVKLSQARVYFEEAIHILNGAFEDLCLVAALYINLAAIYLKQRLRHKGSTLLEKAGALLA
CLPDRESSAKHELEVVAYVLRQGIVVGSSPLEARACFLAIRLLLSLGRHEEVLPFAERLQ
LLSGHPPASEAVASVLSFLYDKKYLPHLAVASVQQHGIQSAQGMSLPIWQVHLVLQNTTK
LLGVPSPGWGEVSALACPMLRQALAACEELADRSTQRALCLILSKVYLQHRSPDGAIHYL
SQALVLGQLLGEQESFESSLCLAWAYLLASQAKKALDVLEPLLGSLKETESLTQRGVVYN
LLGLALQGEGRVNRAARSYLRALNRAQEVGDVRNQAVAMANLGHLSLKSWAQHPARNYLL
QTVRLYCELQASKETDMELVQVFLWLAQVLVSGHQLTHGLLCYETALLFGLRHRHLKSQL
QATKSLCHFYSSVSPNPEACITYHEHWLALAQQLRDREMEGRLLESLGQLYRNLNTARSL
RRSLTCIKESLRIFIDLGERDKAAEAWLGAGRLHYLMQEDELVELYLQAAIQTALKSEEP
LLALKLYEEAGDVFFNGTRHRHHAVEYYRAGAVPLARRLKAVRTELRIFNKLTELQISLE
GYEKALEFATLAARLSTVTGDRRQELVAFHRLATVYYSLHMYEMAEDCYLKTLSLCPPWL
QSPKEALYYAKVYYRLGRLTFCQLKDAHDATEYFLLALAAAVLLGDDELQDTIRSRLDNI
CQSPLWHSSPSGCSSERARWLSGGGLAL
Download sequence
Identical sequences A0A096MN31
ENSPANP00000001022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]