SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001050
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.84e-19
Family Ribosomal protein L24e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001050   Gene: ENSPANG00000006798   Transcript: ENSPANT00000023952
Sequence length 157
Comment pep:known_by_projection chromosome:PapAnu2.0:4:149337941:149338472:1 gene:ENSPANG00000006798 transcript:ENSPANT00000023952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVELCSFSGYKIYPGHGRRYTRTDGKVSQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQMIVKPVRVSAPRVGGKR
Download sequence
Identical sequences A0A096MN58
ENSPANP00000001050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]