SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001065 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001065
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.69e-30
Family Calmodulin-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001065   Gene: ENSPANG00000016651   Transcript: ENSPANT00000020500
Sequence length 189
Comment pep:known_by_projection chromosome:PapAnu2.0:19:14794036:14806847:-1 gene:ENSPANG00000016651 transcript:ENSPANT00000020500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGELSAEEVSLVCEKVLDEADGDHDGRLSLEDFRNMILRAPDFL
RHSTFHIRI
Download sequence
Identical sequences ENSPANP00000001065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]