SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001070 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001070
Domain Number 1 Region: 177-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 240-301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000243
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 53-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000459
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 4 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000129
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001070   Gene: ENSPANG00000003306   Transcript: ENSPANT00000026559
Sequence length 489
Comment pep:known_by_projection chromosome:PapAnu2.0:1:141664532:141803103:1 gene:ENSPANG00000003306 transcript:ENSPANT00000026559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSIGDGFLEQQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGVP
ENGFRTPSAGVFFEGSVTRFHCQDGFKLKGATKRLCMKYFNGTLGWIPSDKSICVQEECR
IPQIEDAEIHNKTYRYGEKLIITCHEGFKIRYPDLYNMFSLCRDDGTWNNLPVCQGCLRP
LAATNGYVNISEFQTSFPVGTVISYRCFPGFKLDGSAFLECLHNLIWSSSPPRCLALEAQ
VCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQVY
CIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSSS
SDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYLASVGQGCPLPVDDQSPPAYPGSGDTD
TGPGEPEACDSVSGSSELLQSLYSPPRCQESTHPASDNPDTIASTVEEVASTSPGIDIAD
EIPLMEEDP
Download sequence
Identical sequences ENSPANP00000001070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]