SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001081 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001081
Domain Number 1 Region: 235-342
Classification Level Classification E-value
Superfamily TPR-like 2.68e-23
Family Tetratricopeptide repeat (TPR) 0.00085
Further Details:      
 
Domain Number 2 Region: 1869-1912
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000127
Family RING finger domain, C3HC4 0.031
Further Details:      
 
Domain Number 3 Region: 492-607
Classification Level Classification E-value
Superfamily TPR-like 0.00000199
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001081   Gene: ENSPANG00000016115   Transcript: ENSPANT00000015531
Sequence length 1935
Comment pep:novel chromosome:PapAnu2.0:X:66777139:66783281:-1 gene:ENSPANG00000016115 transcript:ENSPANT00000015531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFAEGDITVADYALLEDCPYMDNCVFAAEFMTDDYVRVTQLYCDGVGMQYKDYVQSER
NLEFDICSIWCSKPISVLQEYCDAIKINIFWPLLFQHQNSSVISRLHPCVDASNSRASEI
NLKKLQHLELMEDIVDLAKKVANDSFLIGGLLRIGYKIENKVLAMEEALNWIKYAGDVTI
LTKLGSIDNCWPMLSIFFTEYYHITKIVVETAICTAICLKNLKPKNCTDCVEQGELMKMK
GNEEFSKERFDIAIIYYTRAIEYRPENHLLYGNRLCFLRTGQFRNALGDGKRATILKNTW
PKGHYRYCDALSMLGEYNWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQIEDLQGRTA
NKNPIKAFYENRAYTPRSLSAPVFSTSLNFVEKERDFRKFNHEMANGGNQNLKVVDEALK
VDDCDCHPEFSPPSSQPPKHKGKQKSGNNESEKYSSSSQLTLPANLKNILEKQFSKSSRA
AHQDFANIMTMLRSLIQDGYTALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLV
VYGLAISLLGIGQPEELSEAENQFKRIIEHYHNEGLDCLAYCGIGKVYLKKNRFLEALNH
FEKARTLIYRLPGVLTWPTSNVIIEESQPKIKMLLEKFVEECKFPPVPDAICCYQKCCGY
SKIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCE
GVISKIIIFSSGGQVKCEFEHKVIKEKVPPRPILKQKCSSLLAQERMEEDLRESNLPKNE
EQKETVDNVHRCQFLDDRILQCIKQYADKIKSGIWNTATLLKELLSWKVLSTEDYTTCFS
SRNFLNEAVDYVIHHLIQEKSRVKTRIFLHVLSELKEVEPKLAAWIQKLNSFGLDATGPF
FSRYGASLKQLDFSIMTFLWNEKYGHKLDSIEGKQLDYFYEPTSLKEARCLIWLLEEHRD
KFPALHSALDEFFDIMDSRCTVLRKQDGGEAQFSSTKVKNKGKKKKLKDSKPMLVGSGTT
SVTPNNEIITSSEDHSNQNSDTAGPFAVPDHLRQDVEEFEALYDQHSNEYVVRNKKLWDF
NPKQKYSTLYDYFSQMLEEHGPLDMSSKMFSEEYEFFPEETRPILEKAGGLKSFLLGCPR
FVVIDNCIALKKAALRLTGEYLQVKLPLNSAAREFKPDVKPKPVSDSSSALPSEDVKPKP
ASANSPKPACEDVKAKPLSGNSSRQVSEDGETKGVSSNSPKPGSEDANYKQVSSNSPKPV
LEDVKPTYWAQSHLVTGYCTYLPFQRFDITRTPPAYINVLPGLPQYTSTYTPLASLSPEY
HLPTSVPVVPSFVANDRADKNATAYFEGHHLNAENAAGHQIASETQILEDSLVTSVKSQC
STGDAYMVLSESDRNDGHCGNSNNKCEVIPESTSAVTNIPHVQMVAVQVSWNITHQEVNT
EPYNPFDEQQGEVSRIEKEYQVLQDQLKEACENYEQIILKGLEETRDLEEKLKRHLEENK
MSKMELDWFLQDLVSNASAMYTQKNDGKDKEHELHLDQSLEIRNTLINKKMKIEECIKKG
KEDYEESHQRAVAAEVSVLENWKESEVYKLQIMESQAESYLKQLELISHDPAAYPHMQSD
ICSWELFLSHVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQIPKLSFPACNVVHPELLS
ESSGHDDQGLMTSASYVTGNLAAFHRDSSVFSASDSPGEAPSALLPGPPPSQPEATQLPG
PKRDGQAALSEQSPVADQKQPVPPGLVFPCYDSTELAGFIKNVRSKNKSSLSGLSIDEIV
QRVTEHILDEQKKKKPNPGKDKRTYEPSSAAPVTRSSQDPPSAVIAPSPKTKGQKAEDVP
VRVAPGASSCEICHKMFKSKNVCVLKCGHKYHKGCFKQWLKGQSACPACQSHDLLSASGR
GWASEKWELPSCSPR
Download sequence
Identical sequences ENSPANP00000001081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]