SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001110 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001110
Domain Number 1 Region: 79-181
Classification Level Classification E-value
Superfamily t-snare proteins 7.14e-33
Family t-snare proteins 0.00000957
Further Details:      
 
Domain Number 2 Region: 227-294
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.36e-16
Family SNARE fusion complex 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001110   Gene: ENSPANG00000012122   Transcript: ENSPANT00000001172
Sequence length 324
Comment pep:known_by_projection chromosome:PapAnu2.0:19:11926419:11932820:-1 gene:ENSPANG00000012122 transcript:ENSPANT00000001172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGSCLCPQPRWLQRGRKCPHVRPPRPLFLPWRSRSRWWRDGGRGWWRVLLGWERTSPR
TQAGRGFRPGGKGIDMSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESPAVGREELDW
TTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDH
MVSPTAVAFLERNNREILAGKPAPQKSLSDLLDASAVSATSRYIEEQQATQQLIMDEQDQ
QLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSD
RRQWCAIAVLVGVLLLVLILLFSL
Download sequence
Identical sequences ENSPANP00000001110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]