SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001144 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001144
Domain Number 1 Region: 897-1105
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-63
Family Protein kinases, catalytic subunit 0.0000228
Further Details:      
 
Domain Number 2 Region: 585-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-44
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 3 Region: 459-562,591-616
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000516
Family SH2 domain 0.0056
Further Details:      
 
Domain Number 4 Region: 385-446
Classification Level Classification E-value
Superfamily PH domain-like 0.000000615
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 150-275
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000628
Family Second domain of FERM 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001144   Gene: ENSPANG00000019963   Transcript: ENSPANT00000006743
Sequence length 1127
Comment pep:known_by_projection chromosome:PapAnu2.0:19:9298698:9331792:-1 gene:ENSPANG00000019963 transcript:ENSPANT00000006743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAEPPAGSMPLRHRGTTRGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSL
TAEEVCIHIAHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRMRFYFRN
WHGMNPQEPAVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELS
SEEEIHHFKNESLGMAFLHLCHLALRRGVPLEEVAKKTSFKDCIPLSFRRQIRQHSALTR
LRLRNVFRRFLQDFQPDRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPC
YIRESGEAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVQEEVNKEEGSSGGSGRNPQASL
SGKKAKAHKAIGQPADRLREPLWAYFCDFRDITHVVLKECCVSIHRQDNKCLELSLPSRA
AALSFVSLVDGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVQAKLRPEDGLY
LIQWSTSHPYRLILTVAQRSQAPDGTQSLRLRKFPIEQQARAFVLEGWGRSFPSVRELGA
ALQGCLLRAGDDCFSLRRCCLPQPGETSNLIIMRGARASTRTLNLSQLSFHRVDQKEITQ
LSHLGQGTRTNVYEGRLRVEGSGDPEEGKVDDEDPLVPGGDRGQELRVVLKVLDPSHHDI
ALAFYETASLMSQVSHVHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWK
MVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREE
RVERIPWMAPECLPGGPNSLSIAMDKWGFGATLLEICFDGEAPLQSRSSSEKEHFYQRQH
RLPEPSCPELATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLIVNPDSSASDPTV
FHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIEIL
RTLYHEHIVKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGM
AYLHAQHYIHRDLAARNVLLDNDKLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPE
CLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTVRARPAAPPGVC
Download sequence
Identical sequences ENSPANP00000001144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]