SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001168 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001168
Domain Number 1 Region: 527-744
Classification Level Classification E-value
Superfamily TPR-like 1.21e-28
Family Tetratricopeptide repeat (TPR) 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001168
Domain Number - Region: 442-523
Classification Level Classification E-value
Superfamily TPR-like 0.00616
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001168   Gene: ENSPANG00000019545   Transcript: ENSPANT00000021082
Sequence length 843
Comment pep:known_by_projection chromosome:PapAnu2.0:13:31662149:31841592:1 gene:ENSPANG00000019545 transcript:ENSPANT00000021082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTPELAILRGFPTEAERQQWKQEGFVGSETGSFLQLLLEGNYEAIFLNSVTQNIFNSAT
TAEEKIDSYLEKQVVTFLDYSTDLDTMERQQLIFLLGVSSLQLFVQSNWTGPPVDLHPQD
FLSSVLFQQFSEVKGLDAFVLSLLALDGESIYSLTSKPILLLLARIILVNVRHKLTAIQS
LPWWTLRCVNIHQHLLEERSPLLFTLAENCIDQVMKLQNLFVDDSGRYLAIQFHLECAYV
FLYYYEYRKAKDQLNIAKNISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE
FTPAPTPQEHLTKNLELNDDTVLNDIKLADCEQFQMPDLCAEELAIILGICTNFQKNNPV
HKLTEEELLAFTSCLLSQPKFWAIQTSALILRTKLERGSTRRVERAMRQTQALADQFEDK
TTSVLERLKIFYCCQVPPHWAIQRQLASLLFELGCTSSALQIFEKLEMWEDVVICYERAG
QHGKAEEILRQELEKKETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHLRN
KEFQECVECFERSVKINPMQLGVWFSLGCAYLALEDYQGSAKAFQRCVTLEPDNAEAWNN
LSTSYIRLKQKVKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRD
KYKDVQVLKILVRAVINGMTDRSGDVTTGLKGKLQELFGRVTSRVTNDGEIWRLYAQVYG
NGQSEKPDENEKAFQCLSKAYKCDTQSNCWEKDITSFKEVVQRALGLAHVAIKCSKNKSS
PQEAVQMLSSVRLNLRGLLSKAKQLFTDVATGEMSRELADDITAMDTLVLELQDLSNQFR
NQY
Download sequence
Identical sequences A0A096MNE2
ENSPANP00000001168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]