SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001180 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001180
Domain Number 1 Region: 403-687
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.1e-41
Family C5 cytosine-specific DNA methylase, DCM 0.0063
Further Details:      
 
Domain Number 2 Region: 60-201
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.5e-38
Family PWWP domain 0.0000149
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001180
Domain Number - Region: 306-374
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000345
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001180   Gene: ENSPANG00000009987   Transcript: ENSPANT00000017162
Sequence length 689
Comment pep:known_by_projection chromosome:PapAnu2.0:13:24268788:24282744:-1 gene:ENSPANG00000009987 transcript:ENSPANT00000017162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGADAGDKNATKAGDDEPE
YEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEK
LMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQN
KPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTE
KPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLE
CAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNC
YMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGI
ATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDL
VIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGV
SDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGR
IAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRL
ARQRLLGRSWSVPVIRHLFAPLKEYFACV
Download sequence
Identical sequences A0A2K5KJ17 A0A2K5UU63 A0A2K6D248 A0A2K6KW17
XP_011899735.1.92194 ENSPANP00000001180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]