SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001215 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001215
Domain Number 1 Region: 305-471,551-665
Classification Level Classification E-value
Superfamily L domain-like 5.1e-51
Family Ngr ectodomain-like 0.0000273
Further Details:      
 
Domain Number 2 Region: 75-282
Classification Level Classification E-value
Superfamily L domain-like 3.61e-41
Family Ngr ectodomain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 939-1129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-39
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 796-907
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 753-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 710-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000724
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 7 Region: 1-44
Classification Level Classification E-value
Superfamily L domain-like 0.00000381
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 8 Region: 1213-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family EGF-type module 0.021
Further Details:      
 
Domain Number 9 Region: 1166-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000385
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001215
Domain Number - Region: 1132-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001215   Gene: ENSPANG00000005313   Transcript: ENSPANT00000003225
Sequence length 1320
Comment pep:known_by_projection chromosome:PapAnu2.0:6:162071839:162288758:-1 gene:ENSPANG00000005313 transcript:ENSPANT00000003225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVC
PAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLTEIPANLPEGIVEIRLEQNSIKSIP
AGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQL
LLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPFVCDC
HLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDL
VCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLNDNEISVLEATGIFKKLPNLRKIN
LSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRMFRGLSGLKTLMLRSNLISCVSND
TFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRI
VSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSCQLSPRCPEQCTCVETVVRCSNKGL
RALPKGMPKDVTELYLEGNHLTAVPRELSALRHLTLIDLSNNSISMLTNYTFSNMSHLST
LILSYNRLRCIPIHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDC
SLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDINIAAKCNACLSS
PCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCS
CPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCVCPPNYTGELCDEVIDHCVPELN
LCQHEAKCIPLDKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCMDTINGYTCTCPQG
FSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFV
GKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYDSLSSP
PTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIP
TSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLC
RSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCNHGKCVATGTSYMCKCAEGYGGALCD
NKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKG
YASCATASKVPIMECHGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLGCS
Download sequence
Identical sequences ENSPANP00000001215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]