SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001255 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001255
Domain Number 1 Region: 80-265
Classification Level Classification E-value
Superfamily PH domain-like 7.23e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000251
Further Details:      
 
Domain Number 2 Region: 422-529
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-28
Family SH2 domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001255   Gene: ENSPANG00000018868   Transcript: ENSPANT00000012516
Sequence length 541
Comment pep:known_by_projection chromosome:PapAnu2.0:19:148158:189449:-1 gene:ENSPANG00000018868 transcript:ENSPANT00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AETANRGRAPPSPPRSPAPRAATTFCALLPRMPQWKFAAPGGFLGDPQSEPASPGGVPAL
AAAVLGACEPRCAAPCPLPALSRCRGAGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCI
EVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMS
ISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILE
CCEGLAQSVISTVGQAFELRFKQYLHSPPKVALPPERLAGPEESAWGDEEEAVEHSYYNS
VPGKEPPPGGLVDSRLALTQPCALTALGQGPSASVRDARSLPWDVGSTGAAPPGDGYVQA
DARGPPDLEEHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGMTAAPLPL
EDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVL
TGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSRE
P
Download sequence
Identical sequences ENSPANP00000001255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]