SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001288 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000001288
Domain Number - Region: 105-178
Classification Level Classification E-value
Superfamily t-snare proteins 0.00251
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001288   Gene: ENSPANG00000017979   Transcript: ENSPANT00000007601
Sequence length 209
Comment pep:known_by_projection chromosome:PapAnu2.0:14:108532802:108539058:-1 gene:ENSPANG00000017979 transcript:ENSPANT00000007601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKNKEKGKKSGAQKKKNWAGADVEAESRHRLVVLEKELLRDHLALRRDEARRAKASKD
RLKQRLQRVEPELEGARSEGKAIYAEMSRQCHALQEDMQSRSKQLEEEVKGLWGQLEACQ
REAAAAREEAEQALRERDQALSQLRTHVADMEAKYEEILQDSLDRLLAKLRAIKSQWDGT
AFRLHARHKEQLRQFGLTPGSLRPPAPSL
Download sequence
Identical sequences ENSPANP00000001288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]