SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001314 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001314
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily t-snare proteins 2.54e-34
Family t-snare proteins 0.00000124
Further Details:      
 
Domain Number 2 Region: 159-225
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000113
Family SNARE fusion complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001314   Gene: ENSPANG00000004517   Transcript: ENSPANT00000004207
Sequence length 255
Comment pep:known_by_projection chromosome:PapAnu2.0:1:183302247:183348697:1 gene:ENSPANG00000004517 transcript:ENSPANT00000004207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTAEKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSI
GVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLILFLVL
Download sequence
Identical sequences A0A096MNQ2 A0A2K5P8E1
ENSPANP00000001314 XP_011904159.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]