SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001316 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001316
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.7e-18
Family THAP domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001316
Domain Number - Region: 153-201
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0149
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001316   Gene: ENSPANG00000016871   Transcript: ENSPANT00000017100
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:5:53367398:53378929:-1 gene:ENSPANG00000016871 transcript:ENSPANT00000017100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNH
HLVGAASCIKEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQ
KSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIA
Download sequence
Identical sequences A0A096MNQ4 A0A2K6DSY6 G7P5J7
ENSPANP00000001316 XP_005555108.1.63531 XP_005555109.1.63531 XP_005555110.1.63531 XP_005555111.1.63531 XP_011732026.1.29376 XP_011732027.1.29376 XP_011732029.1.29376 XP_011732030.1.29376 XP_011732031.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]