SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001369 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001369
Domain Number 1 Region: 12-130
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 8.97e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 
Domain Number 2 Region: 225-386
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.09e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00036
Further Details:      
 
Domain Number 3 Region: 1-35,134-208
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-18
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001369   Gene: ENSPANG00000001781   Transcript: ENSPANT00000017484
Sequence length 386
Comment pep:novel chromosome:PapAnu2.0:6:1786:23449:1 gene:ENSPANG00000001781 transcript:ENSPANT00000017484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLA
SRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKE
PIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLL
DLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKS
MQNHAAVFRVGSVLREGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQT
IYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVT
LEYRPVIDRTLNEADCATVPPAIRSY
Download sequence
Identical sequences ENSPANP00000001369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]