SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001374 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001374
Domain Number 1 Region: 347-481
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-36
Family Synaptotagmin-like (S variant) 0.00083
Further Details:      
 
Domain Number 2 Region: 492-633
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-33
Family Synaptotagmin-like (S variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 8-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.61e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001374   Gene: ENSPANG00000014703   Transcript: ENSPANT00000011641
Sequence length 670
Comment pep:known_by_projection chromosome:PapAnu2.0:X:90506184:90531667:-1 gene:ENSPANG00000014703 transcript:ENSPANT00000011641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIKRLKNELLEIKRKGAKRGSQHYSD
RTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFY
DQKVNRFAYRTGSELIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQREPS
VLFEVPKLKSGKSALEAESESLDSFTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKE
TQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVGHESGSLGDRSKSVPGL
NVDMEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFGNIFVTGRIA
FSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTIN
PLYDETLRYEIPESLLTQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLH
GKISAESPTGLPSHKGELVVSLKYIPASKPPVGGDRKKSKGGEGGELQVWIKEAKNLTAA
KAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTV
WDREPLASNDFLGGVRLGVGTGNSNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLR
SSMAKQKLGL
Download sequence
Identical sequences A0A096MNV2 A0A2K5MV24 A0A2K5ZRI6
XP_011820194.1.47321 XP_011820195.1.47321 XP_011820196.1.47321 XP_011929059.1.92194 XP_011929060.1.92194 ENSPANP00000001374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]