SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001396 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001396
Domain Number 1 Region: 111-297
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.21e-75
Family F-box associated region, FBA 0.0000000155
Further Details:      
 
Domain Number 2 Region: 42-141
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000497
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001396   Gene: ENSPANG00000018131   Transcript: ENSPANT00000012555
Sequence length 297
Comment pep:known_by_projection chromosome:PapAnu2.0:1:14490139:14499707:-1 gene:ENSPANG00000018131 transcript:ENSPANT00000012555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEEQPDEASAEEERPEDQEEEEEEAVAAAYLDELPEPLLLRVL
AALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGAEEERDHWQQFYFLSKR
RRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKA
QIIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHEDVLAEFSSGQV
AVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences A0A096MNX2 A0A2K5NKE6 A0A2K5UNI4
XP_005544857.1.63531 XP_011904741.1.92194 ENSPANP00000001396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]