SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001400 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001400
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-50
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000002
Further Details:      
 
Domain Number 2 Region: 203-341
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000232
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001400   Gene: ENSPANG00000013223   Transcript: ENSPANT00000027818
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:6:73439295:73579039:-1 gene:ENSPANG00000013223 transcript:ENSPANT00000027818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
Download sequence
Identical sequences A0A0D9RRT7 A0A287D3H3 A0A2I3MSS7 A0A2K5KB23 A0A2K5NGF1 A0A2K5U708 A0A2K5YH71 A0A2K6AVD4 E2RT37 G3QFA5 H9EPI5 M3Y0V0
ENSMPUP00000004951 NP_001248499.1.72884 XP_004058693.1.27298 XP_004374524.1.4749 XP_004405648.1.74151 XP_004678234.1.23501 XP_004703574.1.18182 XP_004766872.1.14098 XP_005329054.1.77405 XP_006143584.1.99106 XP_006889909.1.29581 XP_007974578.1.81039 XP_008709243.1.72690 XP_011219274.1.58354 XP_011728374.1.29376 XP_011728375.1.29376 XP_011728376.1.29376 XP_011728377.1.29376 XP_011728378.1.29376 XP_011728379.1.29376 XP_011728380.1.29376 XP_011814593.1.43180 XP_011847590.1.47321 XP_011944589.1.92194 XP_015307117.1.63531 XP_015353323.1.40921 XP_019583743.1.88060 XP_849709.1.84170 ENSCAFP00000013344 ENSPANP00000001400 ENSGGOP00000000972 ENSGGOP00000000972 ENSCAFP00000013344 ENSMPUP00000004951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]