SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001415 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001415
Domain Number 1 Region: 117-214
Classification Level Classification E-value
Superfamily EF-hand 7.02e-26
Family Eps15 homology domain (EH domain) 0.0000275
Further Details:      
 
Domain Number 2 Region: 264-364
Classification Level Classification E-value
Superfamily EF-hand 3.42e-25
Family Eps15 homology domain (EH domain) 0.0000784
Further Details:      
 
Domain Number 3 Region: 16-105
Classification Level Classification E-value
Superfamily EF-hand 4.76e-17
Family Eps15 homology domain (EH domain) 0.0000891
Further Details:      
 
Domain Number 4 Region: 386-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000915
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001415   Gene: ENSPANG00000010521   Transcript: ENSPANT00000019386
Sequence length 926
Comment pep:known_by_projection chromosome:PapAnu2.0:19:14987891:15106546:-1 gene:ENSPANG00000010521 transcript:ENSPANT00000019386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLADLSEGVSLAERGGFGAMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFCGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSEAMAEQKNSALYTLLGGKSTPVSQLGSADFPETPDPFQPLGADSGDP
FQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTSFGNEEQQLAWAKRESEKAEQER
LARLRRQEQEDLELAIALSKADMPAA
Download sequence
Identical sequences ENSPANP00000001415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]