SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001425 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001425
Domain Number 1 Region: 26-213
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000375
Family Tetratricopeptide repeat (TPR) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001425   Gene: ENSPANG00000000052   Transcript: ENSPANT00000002550
Sequence length 372
Comment pep:novel chromosome:PapAnu2.0:X:142196544:142197659:1 gene:ENSPANG00000000052 transcript:ENSPANT00000002550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAGLGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQE
CLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAA
ASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAAL
QALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPGPQPGPGTGATPA
LPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYS
WEAFDSHGQESSGQLPEELFLLLQSLVMAAHEKDTEAIKSLQVEMWPLLTAEQNHLLHLV
LQETISPSGQGV
Download sequence
Identical sequences A0A096MNZ3
ENSPANP00000001425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]