SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001455 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001455
Domain Number 1 Region: 63-193
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.18e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.000000745
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001455
Domain Number - Region: 6-62
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000551
Family Glutathione S-transferase (GST), N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001455   Gene: ENSPANG00000018532   Transcript: ENSPANT00000022067
Sequence length 194
Comment pep:novel chromosome:PapAnu2.0:4:151208013:151208597:1 gene:ENSPANG00000018532 transcript:ENSPANT00000022067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPMTQGYWDICGLTHTICLLQQYTDSSYEEKKDFPNLRYLTDGAHKITQSKAILGCIAYK
HNLCGETEREKIWEDSLDNQLMDNHMQLARLSYNADFEKLKPGYLEALPAMLKFYLQFLG
KQPWFLGDKIALVDFIAYDVLERNQVFEPKCLDAFPNLKDFISRFEGLEISAYTKSSRFL
PRPVFTKMAVWGNK
Download sequence
Identical sequences ENSPANP00000001455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]