SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001555 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001555
Domain Number 1 Region: 415-546
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.96e-42
Family Synaptotagmin-like (S variant) 0.0004
Further Details:      
 
Domain Number 2 Region: 550-684
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-40
Family Synaptotagmin-like (S variant) 0.0000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001555   Gene: ENSPANG00000022956   Transcript: ENSPANT00000020450
Sequence length 686
Comment pep:known_by_projection chromosome:PapAnu2.0:14:12158696:12219584:1 gene:ENSPANG00000022956 transcript:ENSPANT00000020450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPD
SGRGRSEKKAINDLDRDFWNNNESTVQQKWSSYPPKEFILNISPYAPYGDPRLSLNGTLL
SGAKVAAAAGLAVEREGRLGEKPAPVPPPGEDALRSGGAAPSEPGSSGKAGRGRWRTVQS
HLAAGKLNLSNFEDSTLSTATTLESIPSSTGEPKCQRPRTLMRQQSLQQPLSQHQRGRQP
SQPTTSQSLGQLQAHMASAPGPNPRAYGRGQARQGTSAGSKYRAAGGRSRSNPGSWDHVV
GQIRNRGLDMKSFLEGRMVVLSLVLGLSEQDDFANIPDLQNPGTQQNQNAQGDKRLPAGG
KAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLG
RIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLN
PHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDL
KPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRV
EKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDRLSRNDVIGKIYLSWKSG
PGEVKHWKDMIARPRQPVAQWHQLKA
Download sequence
Identical sequences A0A096MPA7 A0A2K6EAT1
ENSPANP00000001555 XP_011718684.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]