SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001565 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001565
Domain Number 1 Region: 620-671
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000535
Family PHD domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 205-263
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000199
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 64-127
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000601
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001565
Domain Number - Region: 693-798
Classification Level Classification E-value
Superfamily Bromodomain 0.00116
Family Bromodomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001565   Gene: ENSPANG00000014391   Transcript: ENSPANT00000009102
Sequence length 834
Comment pep:known_by_projection chromosome:PapAnu2.0:19:51224847:51230852:1 gene:ENSPANG00000014391 transcript:ENSPANT00000009102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAAAASAAAASAASGSPGPGESSAGGEKRSTASSTAASASASASVSSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGAVVDCPVC
KQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEA
HQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDH
QYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAIL
QIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTA
LLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSDDPYSSAEPHVSGVKRSRSGEGEVSGL
MRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGT
PGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSS
GLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPG
EEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLH
QLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKAD
VQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP
Download sequence
Identical sequences A0A2K5MDF8
XP_011749986.1.29376 XP_011931713.1.92194 ENSPANP00000001565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]