SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001581 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001581
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily EF-hand 5.22e-28
Family S100 proteins 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001581   Gene: ENSPANG00000003825   Transcript: ENSPANT00000027416
Sequence length 104
Comment pep:novel chromosome:PapAnu2.0:4:75286403:75286714:-1 gene:ENSPANG00000003825 transcript:ENSPANT00000027416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVSSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRIMKRLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKR
Download sequence
Identical sequences ENSPANP00000001581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]