SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001617 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001617
Domain Number 1 Region: 181-374
Classification Level Classification E-value
Superfamily TPR-like 7.78e-31
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 63-192
Classification Level Classification E-value
Superfamily TPR-like 5.69e-17
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001617   Gene: ENSPANG00000017886   Transcript: ENSPANT00000014594
Sequence length 688
Comment pep:known_by_projection chromosome:PapAnu2.0:1:109827790:109873925:1 gene:ENSPANG00000017886 transcript:ENSPANT00000014594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKT
LSAIYSQLGNAYFYLHDYAKALEYHHHDLTLASRTIGDQLGEAKASGNLGNTLKVLGNFD
EAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGYPGPQDVGEFPEEVRDALQ
AAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKA
AERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYE
KAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKS
GELTARLNLSDLQMVLGLSYSTNNSIMSENTEIESSLNDKGVRPKLGRRHSMENMELMKL
TPEKIQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKCKTNSSTKVLQDASNSIDHRIPD
SQRKISADTIGDEGFFDLLSRFQSNRMDDQRCCLQEKNSHTASTTTSSTPPKMMLKTPSV
PVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNNSQSVLSHLMTNDNKEADED
FFDILVKCQGSRLDDQRCAPPPATTKGPTVPDEDFFSLILRSQAKRMDEQRVLLQRDQNR
DTDFGLKDFLQSNALLEFKNSGKKSADH
Download sequence
Identical sequences ENSPANP00000001617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]