SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001618 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001618
Domain Number 1 Region: 192-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.63e-83
Family Mitochondrial carrier 0.0000296
Further Details:      
 
Domain Number 2 Region: 11-186
Classification Level Classification E-value
Superfamily EF-hand 1.02e-39
Family Calmodulin-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001618   Gene: ENSPANG00000012520   Transcript: ENSPANT00000019961
Sequence length 477
Comment pep:known_by_projection chromosome:PapAnu2.0:1:109039149:109091961:-1 gene:ENSPANG00000012520 transcript:ENSPANT00000019961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFVLPTAACQEAEPPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEQQAELILQSIDADGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences A0A096MPG5 A0A2K5K9S7 A0A2K5VS08 A0A2K6QIT8 F7H259
ENSPANP00000001618 ENSMMUP00000003739 9544.ENSMMUP00000003739 ENSMMUP00000003739 NP_001245014.1.72884 XP_005542594.1.63531 XP_010369658.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]