SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001650 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001650
Domain Number 1 Region: 65-437
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.66e-98
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001650   Gene: ENSPANG00000015349   Transcript: ENSPANT00000005090
Sequence length 601
Comment pep:known chromosome:PapAnu2.0:1:125000321:125049040:1 gene:ENSPANG00000015349 transcript:ENSPANT00000005090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSGPSSSVGFSSFDPAVPSCTSSSASGIKRPVAPEVPYASGMPIKKIGHRSVDSSG
ETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHH
YNDFRFKTYAPVAFRYFRELFGIRPDDYLCWDYRHEPLMRSCYVAHAGLKFLSSSDPPFG
LPKYWDYRHELLHLAIKGGWVNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSV
KMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDC
LVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEAR
RGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVH
RPGFYAERFQRFMCNTVFKKIPLKPSPSKFRSGSSFSRRVGSSGNSCITYQPSVSGEHKT
QVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPIVGETLQMLTTSKRKASE
DLEQDSAISVIPRCVSPCPSNAEFSSTWSSKKECNRSEGSSSSIFLLKKNLLSFPFLMNG
H
Download sequence
Identical sequences ENSPANP00000001650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]