SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001670
Domain Number 1 Region: 597-676
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000102
Family Canonical RBD 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001670
Domain Number - Region: 276-302
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000235
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 317-329
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001670   Gene: ENSPANG00000015776   Transcript: ENSPANT00000027595
Sequence length 1056
Comment pep:novel chromosome:PapAnu2.0:6:139736398:139819179:1 gene:ENSPANG00000015776 transcript:ENSPANT00000027595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKE
TSGFVDKLFESLYTKNYLPPLEPVKPEPKPLVQEKEDIKEEVFQEPAEEERDGRKKKYPS
PQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREKYDWRRGRSKSRSKSRGLSRSR
SRSRGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPNSSEQYSSGAQSIPSTV
TVIAPAHHSENTTESWSNYYNNHSSSNSFGRNLPPKRRCRDYDERGFCVLGDLCQFDHGN
DPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGPGPGPGPGPGPGPGHS
MRLPVPQGHGQPPPSVVLPIPRPPITQSSLINSRDQPGTSAVPNLASVGTRLPPPLPQNL
LYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLV
PDTYEPDGYNPEAPSITSSGRSQYRQFFSRTQTQRPNLIGLTSGDMDANPRAANIVIQTE
PPVPVSINSNITRVVLEPDSRKRAMSGLDGPLTKKPWLGKQGNNNQNKPGFLRKNQYTNT
KLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEA
VLNNRFIRVLWHRENNEQPTLQSSAQLLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQST
PSTVHGGIQKMMNKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQVYL
SNFHVAVRNLLVKFFSFSKLICVFQKFHYYSKLIKKFQEAMKLQQDMRKKRQEVLEKQIE
CQKMLISKFMKPEERANIMKTLKELGEKISQLKDELKTSSAVSTPSKVKTKTEAQKELLD
TELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTMSSQGRGRGRGRGGRGRG
SLNHMVVDHRPKALTVGGFIEEEKEDLLQHFSAANQGPKFKDRRLQISWHKPKVPSISTE
TEEEEVKEEETETSDLFLPDDDDEDEDEYESRSWRR
Download sequence
Identical sequences ENSPANP00000001670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]