SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001687 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001687
Domain Number 1 Region: 410-495
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.43e-22
Family Canonical RBD 0.0043
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily SAP domain 0.0000000659
Family SAP domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001687   Gene: ENSPANG00000007770   Transcript: ENSPANT00000005826
Sequence length 941
Comment pep:known_by_projection chromosome:PapAnu2.0:19:5385959:5431478:1 gene:ENSPANG00000007770 transcript:ENSPANT00000005826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLSGLGDSGAAGAAALSSASSETGTRRLSDLRVIDLRAELRKRNVDSSGNKSVLMER
LKKAIEDEGGNPDEIEITSDGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSL
ENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQE
HAVEIEDKETINNLDTSSSDFTILQEIEEPSLEPENEKILDILGETCKSEPVKEESSELE
QPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPA
EQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAATEAASPEARDSKEDGRKFD
FEACNEVPPAPKESSTSEGADQKMSSPEDDSDTKRLSKEEKEIGRSSCGRNFWVSGLSST
TRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKM
ISVEKAKNEPVGKKTSDKRDSDGKKEKSSNSDRYLSSLATLKGSANLKRDDKCDRKDDAK
KGEDGSGEKSKDQDDQKPGPSERSRATKSGSRGTERTVVMDKSKGVPVISVKTSGSKERA
SKSQDRKSASREKRSVVSFDKVKEPRKSRDSESHRTETQLSQRRCRVRERSEREQRMQAQ
WEREERERLEIARERLAFQRQRLERERMERERLERERMHVEHERRREQERIHREREELRR
QQELRYEQERRPAVRRPYDLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDRGR
YPDHSVDRREGSRSMMGEREGQHYPERHGGPERHGRDSRDGWGGYGSDKRMSEGRGLPPP
PRGRRDWGDHGRREDDRAWQGTADGGMMDRDHKRWQGGERSMSGHSGPGHMMNRGGMSGR
GSFAPGGASRGHPIPHGGMQGGFGGQSRGSRPSDARFTRRY
Download sequence
Identical sequences ENSPANP00000001687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]