SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001712 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001712
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 4.45e-234
Family Phosphoglucose isomerase, PGI 8.39e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001712   Gene: ENSPANG00000008545   Transcript: ENSPANT00000027736
Sequence length 558
Comment pep:known_by_projection chromosome:PapAnu2.0:19:29011551:29051777:1 gene:ENSPANG00000008545 transcript:ENSPANT00000027736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRDPQFQKLQQWYREHGSELNLRRLFDADKDRFNHFSLTLNTNHGHILLDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSEGPR
VWYVSNIDGTHIAKTLTQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
Download sequence
Identical sequences A0A0A0MUJ3 A0A2K5KPU0 A0A2K5W4A2 A0A2K6C0D2
XP_005588841.1.63531 XP_011763591.1.29376 XP_011763592.1.29376 XP_011898870.1.92194 ENSPANP00000001712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]