SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001728 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001728
Domain Number 1 Region: 4-293
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-80
Family BAR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 404-519
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.32e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 264-369
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 649-767
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-25
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001728   Gene: ENSPANG00000017081   Transcript: ENSPANT00000011182
Sequence length 817
Comment pep:known_by_projection chromosome:PapAnu2.0:2:185215390:185386706:-1 gene:ENSPANG00000017081 transcript:ENSPANT00000011182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKAALQDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQL
VYQKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAV
QTSIATAYREKGDESEKLDKKSSPSTGSLDSGSESKEKLLKGESALQRVQCIPGNASCCD
CGLADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVIN
RVYEANVEKMGIKKPQPGQRQEKEAYIKAKYVERKFVDKYSISLSPPEQQKKFVSKSSEE
KRLSISKFGPGDQVRASAQSSVIAVNSDEARRESLFCPDELDSLFSYFDTSSKLRSIKSN
DSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSVFLDSKHLNPGLQLYRASYEKNLPK
MAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFLLQNGANVNQRDVQGRGPLHHA
TVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANADIVTLLRLARMNEEMRESEGL
YGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences A0A2K5MSE0 A0A2K5X445
XP_005545390.1.63531 XP_011721365.1.29376 XP_011892137.1.92194 XP_014987973.1.72884 ENSPANP00000001728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]