SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001729 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001729
Domain Number 1 Region: 41-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000269
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 132-177
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000778
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001729   Gene: ENSPANG00000009841   Transcript: ENSPANT00000004335
Sequence length 209
Comment pep:known_by_projection chromosome:PapAnu2.0:1:28586315:28602223:1 gene:ENSPANG00000009841 transcript:ENSPANT00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
GPSAQGKPTYFREEEEEIHSPALLPETQN
Download sequence
Identical sequences A0A096MPR7
ENSPANP00000001729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]