SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001734 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001734
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000141
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001734   Gene: ENSPANG00000018863   Transcript: ENSPANT00000005426
Sequence length 163
Comment pep:known_by_projection chromosome:PapAnu2.0:14:113711675:113733049:1 gene:ENSPANG00000018863 transcript:ENSPANT00000005426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQVSGKEEETSVTILDSSEEDKEKEEVAAVK
IQAAFRGHVAREEVKKMKTDSLQNEEKEENSEDTGFTSRTHEK
Download sequence
Identical sequences A0A096MPS2 Q95230
ENSPANP00000001734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]