SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001745 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001745
Domain Number 1 Region: 542-734
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000185
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 303-375,465-503
Classification Level Classification E-value
Superfamily TPR-like 0.0000273
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001745
Domain Number - Region: 240-333
Classification Level Classification E-value
Superfamily TPR-like 0.0948
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001745   Gene: ENSPANG00000014785   Transcript: ENSPANT00000006020
Sequence length 756
Comment pep:known_by_projection chromosome:PapAnu2.0:11:120604156:120654686:-1 gene:ENSPANG00000014785 transcript:ENSPANT00000006020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVSREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKE
LNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRS
LRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYV
LLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELID
ISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAE
QGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALN
SIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTI
ALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILD
KGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQAR
LYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
Download sequence
Identical sequences ENSPANP00000001745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]