SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001795 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001795
Domain Number 1 Region: 58-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-48
Family Regulator of G-protein signaling, RGS 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001795   Gene: ENSPANG00000009051   Transcript: ENSPANT00000001766
Sequence length 195
Comment pep:known_by_projection chromosome:PapAnu2.0:1:181609039:181634112:1 gene:ENSPANG00000009051 transcript:ENSPANT00000001766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKR
LSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKRSTAKLVSKA
HRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRS
KMYLDLLSQSQRRLS
Download sequence
Identical sequences ENSPANP00000001795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]