SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001816 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001816
Domain Number 1 Region: 226-293
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000102
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001816
Domain Number - Region: 157-182
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000327
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 292-320
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000733
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001816   Gene: ENSPANG00000009346   Transcript: ENSPANT00000016578
Sequence length 462
Comment pep:known_by_projection chromosome:PapAnu2.0:6:106707409:106708836:1 gene:ENSPANG00000009346 transcript:ENSPANT00000016578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALEKMTFPEKPSHKKYRAALKKEKRKKCRQELARLRDSGLSHTFIEEQQLEEEKLLER
ERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKWQEQERKLKEQWKEQQRKDREEEDQKQQ
EEAVQKMLDQAENELENGTIWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHN
FPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEEIYQQFLDFYEDVLPEFKNVGK
VIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAIC
GLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIHLSPDQTGSSFGKNSERRERMGHHDH
YSSRLRGRRNPSPDHSYKRNGESERKRSSHRGKKSHKHTSKSREKHNSPSRGRNRHRSQG
QGHRSQSRRSHRSRSQSSSRSRSRGRRRSGNRGRTVQSPKSK
Download sequence
Identical sequences ENSPANP00000001816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]