SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001863 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001863
Domain Number 1 Region: 637-852
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-106
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 510-635
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.54e-35
Family TSP type-3 repeat 0.00000525
Further Details:      
 
Domain Number 3 Region: 126-171
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.2e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 441-512
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.85e-16
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 367-453
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000248
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 281-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 199-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001863
Domain Number - Region: 8-63
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000104
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number - Region: 331-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00625
Family EGF-type module 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001863   Gene: ENSPANG00000001778   Transcript: ENSPANT00000026647
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:6:74078461:74127912:1 gene:ENSPANG00000001778 transcript:ENSPANT00000026647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRLLLRLSNLQRGAGSLELYLDCIQVD
SIHNLPRAFAGLSQNPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPL
AATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTP
STMVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTGSGITCIDVDECK
YHPCYPGVRCVNLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVSN
SICINTLGSYRCGPCKPGYTGDQIRGCKMERNCRNPELNPCSVNAQCIEERQGDVTCVCG
VGWAGDGYVCGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDA
DGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGDGRGDACDDDMD
GDGIKNILDNCPRFPNRDQRDKDGDGVGDACDSCPDISNPNQSDVDNDLVGDSCDTNQDS
DGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQ
EDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWV
VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVV
MWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSR
NVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENI
IWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
Download sequence
Identical sequences ENSPANP00000001863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]