SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001914 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001914
Domain Number 1 Region: 72-443
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.52e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001914   Gene: ENSPANG00000007590   Transcript: ENSPANT00000006691
Sequence length 668
Comment pep:known_by_projection chromosome:PapAnu2.0:19:3424964:3487341:-1 gene:ENSPANG00000007590 transcript:ENSPANT00000006691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEALSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGARGTSDEKRPVGQKALYSTAMES
IQGGAARGEPIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDEGVEAS
MAGATAAVEAETASQASDEEGAPASQASDEEDTPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT
Download sequence
Identical sequences A0A0A0MUK6
ENSPANP00000001914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]