SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001925 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001925
Domain Number 1 Region: 258-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 147-287
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 87-172
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001925   Gene: ENSPANG00000015263   Transcript: ENSPANT00000005832
Sequence length 1161
Comment pep:known_by_projection chromosome:PapAnu2.0:1:184853011:184974048:1 gene:ENSPANG00000015263 transcript:ENSPANT00000005832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHEALHRPYG
CDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQ
NGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESE
SSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHY
PAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKE
DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEV
TAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTA
HAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKG
YRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAAS
SSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFVRGAQASSGSP
ALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHK
KYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDNGGGGGGSGTA
GGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTL
PRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEEGAAPSRERPKAKLLPRGATALP
LRTPSGDLAITEKDPPGVGMAGVAAAPKGKEKNGGARLGMAGVLEDGEQPGWPSPAKAAP
VLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPK
CAPPPPPVMRLLQHPSICSDPTEEPTAPTAGQSTSETQEGGKKAALGAVPVSGKAGRPVM
PPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSAIT
EPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPG
ANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences A0A096MQ99
ENSPANP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]