SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001952 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001952
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.69e-69
Family IMD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001952   Gene: ENSPANG00000018427   Transcript: ENSPANT00000025311
Sequence length 746
Comment pep:known_by_projection chromosome:PapAnu2.0:20:55837090:55859313:1 gene:ENSPANG00000018427 transcript:ENSPANT00000025311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKV
ADMATNTRGATRDIGSALTMCMRHRSIETKLRQVHQALLESLINPLQERIEDWKKAANQL
DKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEET
EKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPA
SEQVIKDLKGSDYSWSYQTPPSSPSSSSSRKSSMCSAPSSSSSAKGGGAPWPGGAQTYSP
SSTCRYRSLAQPATTTTRLSSVSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSEA
SETCQSVSECSSPTSDWSKVGSHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGEE
APRPRMSPATIAAKHSEEVSPAASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTPS
CSEDTIPSQGSDYDCYSVNGDADSEGPPEFDKSSTIPRNSNIAQNYRRLIQTKRPASTAG
LPTAGLPTATGLPSGAPPGVATIRRTPSTKPTVRRALSSAGPIPIRPPIVPVKTPTVPDS
PGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAE
DEQQQLAANRHSLVEKLGELVAGAHALGEGQFPFPTALSATPTEETPTPPPAATSDPPAE
DMLVAIRRGVRLRRTVTNDRSAPRIL
Download sequence
Identical sequences ENSPANP00000001952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]